PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF059600070CFD_t1
Common NameTRAES_3BF059600070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 294aa    MW: 31746.4 Da    PI: 7.0877
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF059600070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-162269148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
  TRAES3BF059600070CFD_t1 22 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69
                             678*******************************************97 PP

2Myb_DNA-binding39.91e-1277127345
                              SS-HHHHHHHHHHHHHTTTT.........-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGgg.........tWktIartmgkgRtlkqcksrwq 45 
                              + ++ E+e ++ + k lG++         +W+ Ia++m+ gRt++++k++w+
  TRAES3BF059600070CFD_t1  77 PISKREEETIISLQKSLGNRrlnfheiciRWSVIAAKMP-GRTDNEIKNYWN 127
                              56889**********************************.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9621773IPR017930Myb domain
SMARTSM007172.9E-122171IPR001005SANT/Myb domain
SuperFamilySSF466897.65E-2421126IPR009057Homeodomain-like
PfamPF002492.8E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-212376IPR009057Homeodomain-like
CDDcd001673.26E-102569No hitNo description
SMARTSM007178.2E-1074132IPR001005SANT/Myb domain
PROSITE profilePS5129410.88174134IPR017930Myb domain
CDDcd001671.81E-877127No hitNo description
PfamPF002492.4E-1077128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-1977133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MVEKPASQAD VGGEVEAHKE RKGLWSPEED ERLYTRITRH GVSTWSSVAQ LAGLRRSGKS  60
CRLRWMNYLR PDLKKEPISK REEETIISLQ KSLGNRRLNF HEICIRWSVI AAKMPGRTDN  120
EIKNYWNSRI RKRQNASPAG GKGDSGCAKQ QGDLPAADDK ASVLAGPRAK EPVSSMASGA  180
TAPPVPARFP LFACQLLGCG GGAAAIAAAG TTESTTTHEN NRAGSESDAS VGNGSGGGGD  240
GREGHYYYCA VDGDIDMIHL MSFDDLLEYP ASDLLMDAWD RNGLYSTNTG NSVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-212213327127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.16e-95PREDICTED: myb-related protein Myb4
TrEMBLA0A077RWG70.0A0A077RWG7_WHEAT; Uncharacterized protein
STRINGMLOC_19052.11e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-43myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]